PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G093700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 301aa    MW: 33364.4 Da    PI: 6.4377
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G093700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.7e-4371061100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l++ +reda++sl+yeAear++dPvyG+vg+i+ lq++l++l
  Manes.12G093700.1.p   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNTAQREDAVNSLAYEAEARLHDPVYGCVGLISILQHRLKEL 96 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++l  +k+e
  Manes.12G093700.1.p  97 QSDLYNAKKE 106
                          ***9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6536107IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-437104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MSTPNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNTAQR  60
EDAVNSLAYE AEARLHDPVY GCVGLISILQ HRLKELQSDL YNAKKELSQY IGPQAMLPTL  120
QSPAYMPHQH LSNPNASSMM QHGALPIMGI PCRPTNGGQL VMREPSQQQH QNQIFEAQQL  180
AAALAAREQQ DMFRAYEQQQ EIVRLNRGFD AVDSGTTTGF NQITVAAMSP SLALGSFDTP  240
YQVQQQQVDH PQHHQLEAQL FLLPQESQPQ PHEQQQHSQQ TQQQHQPSGS DEGGSIGLSC  300
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079180.11e-133PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-85LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A067KA721e-133A0A067KA72_JATCU; Uncharacterized protein
STRINGVIT_07s0197g00020.t011e-110(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-83ASYMMETRIC LEAVES 2-like 1